• Satılık
  • Yenilendi
Rekombinant Botryotinia fuckeliana Golgi aparatı membran proteini tvp18 (tvp18)

Rekombinant Botryotinia fuckeliana Golgi aparatı membran proteini tvp18 (tvp18)

 
₺ 84.60

Ürün sayısı
Tova kullanılabilir

Genel ad : BC1 G_03398; tvp18; BC1 G_03398. Syn Name : Rekombinant Golgi aparatı membran proteini tvp18 (tvp18).Golgi aparatı membran proteini tvp18; varsayımsal protein BC1 G_03398. Golgi aparatı membran proteini tvp18; varsayımsal protein.Kaynak : E. Coli veya Maya.Saflık : >%90; * Etiket Bilgisi : Etiketlendi.Türler : Botryotinia fuckeliana (suş B05.10) (Asil çürük mantarı) (Botrytis cinerea).Depolama Tamponu : PBS p H 7.4, %50 gliserol; * Seq Pos : 1-147. Depolama : -20 derece C'de saklayın. Genişletilmiş depolama için -20 veya -80 derece C'de saklayın.Bu öğe için ücretsiz-8 GB-USBDrive.Madde araştırma kullanımı içindir.Teşhis / tedavi prosedürü için değil. * Form : Bu ürün özel üretim gerektirir ve teslim süresi 5-9 hafta arasındadır.Spesifikasyonlarınıza göre özel üretim yapabiliriz.; * Sıra : MTIAEEFATRNFSYGQWTGVVCILLCFALGIANLFHVSLLIIFSALCLVSSFLIIFIEIPLLLRICPTSSTFDTFMRRFTTNYMRAAIYMGMAIVQWLSIIIDASSLIAAAVLLTIAAGFYALAGLKGQGFVGSKTLGGQGVAQMIL; * Katılım# : XP_001558549.1; XM_001558499.1; A6 RRF7; *Uniprot Özeti : İşlev : Benzerlikle veziküler kaçakçılığa karışan Golgi membran proteini.Hücre altı lokasyon : Golgi aparatı membranı; Benzerliğe göre çok geçişli membran proteini.Dizi benzerlikleri : TVP18 ailesine aittir.Sıra dikkat : EDN18114.1 sırası gösterilenden farklıdır.Sebep : Hatalı gen modeli tahmini.


Detaylı karakterislikler

Benzer ürünler